Lineage for d4lf1a1 (4lf1 A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953229Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)
  8. 2953247Domain d4lf1a1: 4lf1 A:1-138 [257016]
    Other proteins in same PDB: d4lf1a2, d4lf1b2, d4lf1c2, d4lf1d2, d4lf1e2, d4lf1f2
    automated match to d2rusb2
    complexed with cap, mg

Details for d4lf1a1

PDB Entry: 4lf1 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with 2-cabp
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf1a1 d.58.9.0 (A:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d4lf1a1:

Click to download the PDB-style file with coordinates for d4lf1a1.
(The format of our PDB-style files is described here.)

Timeline for d4lf1a1: