Lineage for d4le9a1 (4le9 A:85-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783393Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)
  8. 2783398Domain d4le9a1: 4le9 A:85-141 [257010]
    Other proteins in same PDB: d4le9a2
    automated match to d4cc4b_
    complexed with pge

Details for d4le9a1

PDB Entry: 4le9 (more details), 1.34 Å

PDB Description: Crystal structure of a chimeric c-Src-SH3 domain
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4le9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4le9a1 b.34.2.0 (A:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyvasgetdlsfkkgerlqivgynhgdwwlahslttgrtgyipsnyvapsd

SCOPe Domain Coordinates for d4le9a1:

Click to download the PDB-style file with coordinates for d4le9a1.
(The format of our PDB-style files is described here.)

Timeline for d4le9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4le9a2