SCOPe 2.05: Domain d4lcil_: 4lci L:

Lineage for d4lcil_ (4lci L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4lcil_: 4lci L: [257006]
   Other proteins in same PDB: d4lcih_
   automated match to d4llvb_
   complexed with fmt, gol, na

Details for d4lcil_

PDB Entry: 4lci, 1.9 Å

PDB Description: Anti canine CD28 antibody, 1C6

PDB Compounds: (L:) anti canine CD28 antibody, 1C6, light chain

SCOPe Domain Sequences for d4lcil_:

Sequence; same for both SEQRES and ATOM records:

>d4lcil_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdivmtqaapsvpvtpgesvsiscrstksllhsngntylywflqrpgqspqrliyymsnl
asgvpdrfsgrgsgtdftlrisrveaedagvyycmqsleypytfgggtkleikrlvp

Timeline for d4lcil_:

• d4lcil_ first appeared in SCOPe 2.04
  
• d4lcil_ appears in SCOPe 2.06
  
• d4lcil_ appears in the current release, SCOPe 2.07