Lineage for d4lcil_ (4lci L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519113Species Canis lupus [TaxId:9615] [257005] (1 PDB entry)
  8. 1519114Domain d4lcil_: 4lci L: [257006]
    Other proteins in same PDB: d4lcih_
    automated match to d4llvb_
    complexed with fmt, gol, na

Details for d4lcil_

PDB Entry: 4lci (more details), 1.9 Å

PDB Description: Anti canine CD28 antibody, 1C6
PDB Compounds: (L:) anti canine CD28 antibody, 1C6, light chain

SCOPe Domain Sequences for d4lcil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcil_ b.1.1.0 (L:) automated matches {Canis lupus [TaxId: 9615]}
mdivmtqaapsvpvtpgesvsiscrstksllhsngntylywflqrpgqspqrliyymsnl
asgvpdrfsgrgsgtdftlrisrveaedagvyycmqsleypytfgggtkleikrlvp

SCOPe Domain Coordinates for d4lcil_:

Click to download the PDB-style file with coordinates for d4lcil_.
(The format of our PDB-style files is described here.)

Timeline for d4lcil_: