Lineage for d4lcih_ (4lci H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512777Species Canis lupus [TaxId:9615] [257003] (1 PDB entry)
  8. 1512778Domain d4lcih_: 4lci H: [257004]
    Other proteins in same PDB: d4lcil_
    automated match to d1cl7h1
    complexed with fmt, gol, na

Details for d4lcih_

PDB Entry: 4lci (more details), 1.9 Å

PDB Description: Anti canine CD28 antibody, 1C6
PDB Compounds: (H:) anti canine CD28 antibody, 1C6, heavy chain

SCOPe Domain Sequences for d4lcih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcih_ b.1.1.1 (H:) automated matches {Canis lupus [TaxId: 9615]}
qiqlvqsgpelkkpgetvkisckasgytftnygmtwvkqaprkglkwmgwintytgrpty
addfkgrfafsletsastaylqinnlkhedtatyfcaslgedfwgqgttltvsshhhhhh

SCOPe Domain Coordinates for d4lcih_:

Click to download the PDB-style file with coordinates for d4lcih_.
(The format of our PDB-style files is described here.)

Timeline for d4lcih_:

  • d4lcih_ appears in periodic updates to SCOPe 2.04 starting on 2014-07-19
  • d4lcih_ appears in SCOPe 2.05
  • d4lcih_ appears in the current release, SCOPe 2.07, called d4lcih1