Lineage for d4lcih1 (4lci H:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744347Domain d4lcih1: 4lci H:1-110 [257004]
    Other proteins in same PDB: d4lcih2, d4lcil_
    automated match to d1cl7h1
    complexed with fmt, gol, na

Details for d4lcih1

PDB Entry: 4lci (more details), 1.9 Å

PDB Description: Anti canine CD28 antibody, 1C6
PDB Compounds: (H:) anti canine CD28 antibody, 1C6, heavy chain

SCOPe Domain Sequences for d4lcih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lcih1 b.1.1.1 (H:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftnygmtwvkqaprkglkwmgwintytgrpty
addfkgrfafsletsastaylqinnlkhedtatyfcaslgedfwgqgttltvs

SCOPe Domain Coordinates for d4lcih1:

Click to download the PDB-style file with coordinates for d4lcih1.
(The format of our PDB-style files is described here.)

Timeline for d4lcih1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lcih2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lcil_