Lineage for d4l8qa_ (4l8q A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388561Protein automated matches [190035] (28 species)
    not a true protein
  7. 2388647Species Canavalia grandiflora [TaxId:232301] [256991] (1 PDB entry)
  8. 2388648Domain d4l8qa_: 4l8q A: [256992]
    automated match to d2p2ka_
    complexed with ca, cd, gol, mn, so4, xmm

Details for d4l8qa_

PDB Entry: 4l8q (more details), 2.3 Å

PDB Description: crystal structure of canavalia grandiflora seed lectin complexed with x-man.
PDB Compounds: (A:) Canavalia grandiflora seed lectin

SCOPe Domain Sequences for d4l8qa_:

Sequence, based on SEQRES records: (download)

>d4l8qa_ b.29.1.1 (A:) automated matches {Canavalia grandiflora [TaxId: 232301]}
adtivaveldtypntdigdpnyphigidiksirskkiakwnmqdgkvatahiiynsvgkr
lsavvsypnadsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
aetnalhftfnqftkdqkdlilqgdattdsdgnlqltrvssdgtpqgnsvgralfyapvh
iwessavvasfdatftflikspdsdpadgitffisnmdstipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4l8qa_ b.29.1.1 (A:) automated matches {Canavalia grandiflora [TaxId: 232301]}
adtivaveldtypntdigdpnyphigidiksirskkiakwnmqdgkvatahiiynsvgkr
lsavvsypnadsatvsydvdldnvlpewvrvglsattglyketntilswsftsklkaetn
alhftfnqftkdqkdlilqgdattdsdgnlqltrvssdgtpqgnsvgralfyapvhiwes
savvasfdatftflikspdsdpadgitffisnmdstipsgsggrllglfpdan

SCOPe Domain Coordinates for d4l8qa_:

Click to download the PDB-style file with coordinates for d4l8qa_.
(The format of our PDB-style files is described here.)

Timeline for d4l8qa_: