SCOPe 2.05: Domain d1aipe1: 1aip E:213-312

Lineage for d1aipe1 (1aip E:213-312)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology

7. Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries)

8. Domain d1aipe1: 1aip E:213-312 [25699]
   Other proteins in same PDB: d1aipa2, d1aipa3, d1aipb2, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe2, d1aipe3, d1aipf2, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipe1

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

PDB Compounds: (E:) elongation factor tu

SCOPe Domain Sequences for d1aipe1:

Sequence; same for both SEQRES and ATOM records:

>d1aipe1 b.43.3.1 (E:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

Timeline for d1aipe1:

• d1aipe1 first appeared (with stable ids) in SCOP 1.55
  
• d1aipe1 appears in SCOPe 2.04
  
• d1aipe1 appears in SCOPe 2.06
  
• d1aipe1 appears in the current release, SCOPe 2.08