Lineage for d1aipe1 (1aip E:213-312)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801311Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 801340Species Thermus thermophilus [TaxId:274] [50452] (7 PDB entries)
  8. 801348Domain d1aipe1: 1aip E:213-312 [25699]
    Other proteins in same PDB: d1aipa2, d1aipa3, d1aipb2, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe2, d1aipe3, d1aipf2, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipe1

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (E:) elongation factor tu

SCOP Domain Sequences for d1aipe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipe1 b.43.3.1 (E:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1aipe1:

Click to download the PDB-style file with coordinates for d1aipe1.
(The format of our PDB-style files is described here.)

Timeline for d1aipe1: