Lineage for d4l7va_ (4l7v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895137Species Vibrio cholerae [TaxId:345073] [256987] (1 PDB entry)
  8. 2895138Domain d4l7va_: 4l7v A: [256988]
    automated match to d3lbfa_
    complexed with act, ca, sah

Details for d4l7va_

PDB Entry: 4l7v (more details), 2.05 Å

PDB Description: crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d4l7va_:

Sequence, based on SEQRES records: (download)

>d4l7va_ c.66.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
npkadrliqflteqgitspqvlaaihalpreffvapammhqaydnnalpigqgqtisqpy
ivakmtellaltpetkvleigtgsgyqtavlaklvnhvftveriktlqwdakrrlkqldi
ynvstkhgdgwqgwpargpfdailvtaaaakvpqslldqlaeggrmvipvgedeqylyki
vrqggqfiserveavrfvplvagdla

Sequence, based on observed residues (ATOM records): (download)

>d4l7va_ c.66.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
npkadrliqflteqgitspqvlaaihalpreffvapsqpyivakmtellaltpetkvlei
gtgsgyqtavlaklvnhvftveriktlqwdakrrlkqldiynvstkhgdgwqgwpargpf
dailvtaaaakvpqslldqlaeggrmvipvgedeqylykivrqggqfiserveavrfvpl
vagdla

SCOPe Domain Coordinates for d4l7va_:

Click to download the PDB-style file with coordinates for d4l7va_.
(The format of our PDB-style files is described here.)

Timeline for d4l7va_: