Lineage for d1aipb1 (1aip B:213-312)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062736Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2062767Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries)
  8. 2062772Domain d1aipb1: 1aip B:213-312 [25698]
    Other proteins in same PDB: d1aipa2, d1aipa3, d1aipb2, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe2, d1aipe3, d1aipf2, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipb1

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1aipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipb1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1aipb1:

Click to download the PDB-style file with coordinates for d1aipb1.
(The format of our PDB-style files is described here.)

Timeline for d1aipb1: