Lineage for d4l4pa_ (4l4p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832485Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries)
  8. 2832490Domain d4l4pa_: 4l4p A: [256975]
    automated match to d1n82a_
    mutant

Details for d4l4pa_

PDB Entry: 4l4p (more details), 1.9 Å

PDB Description: the mutant(e139a) structure in complex with xylotriose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4l4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4pa_ c.1.8.0 (A:) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
pvigrkdwpllfdidgkpkkaffriidf

SCOPe Domain Coordinates for d4l4pa_:

Click to download the PDB-style file with coordinates for d4l4pa_.
(The format of our PDB-style files is described here.)

Timeline for d4l4pa_: