SCOPe 2.08: Domain d4l4oa1: 4l4o A:10-337

Lineage for d4l4oa1 (4l4o A:10-337)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries)

8. Domain d4l4oa1: 4l4o A:10-337 [256974]
   Other proteins in same PDB: d4l4oa2
   automated match to d1n82a_
   complexed with 144

Details for d4l4oa1

PDB Entry: 4l4o, 2.05 Å

PDB Description: the crystal structure of cbxyn10b in native form

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4l4oa1:

Sequence; same for both SEQRES and ATOM records:

>d4l4oa1 c.1.8.0 (A:10-337) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
vvyswdvvneavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
pvigrkdwpllfdidgkpkkaffriidf

Timeline for d4l4oa1:

• d4l4oa1 first appeared in SCOPe 2.04, called d4l4oa_
  
• d4l4oa1 appears in SCOPe 2.07