SCOPe 2.08: Domain d4l35a_: 4l35 A:

Lineage for d4l35a_ (4l35 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Haloarcula vallismortis [TaxId:28442] [237952] (2 PDB entries)

8. Domain d4l35a_: 4l35 A: [256970]
   automated match to d4jr8a_
   complexed with 22b, ret

Details for d4l35a_

PDB Entry: 4l35, 2.1 Å

PDB Description: Crystal structure of cruxrhodopsin-3 at pH5 from Haloarcula vallismortis at 2.1 angstrom resolution

PDB Compounds: (A:) Cruxrhodopsin-3

SCOPe Domain Sequences for d4l35a_:

Sequence; same for both SEQRES and ATOM records:

>d4l35a_ f.13.1.0 (A:) automated matches {Haloarcula vallismortis [TaxId: 28442]}
mpapegeaiwlwlgtagmflgmlyfiargwgetdsrrqkfyiatilitaiafvnylamal
gfgltiveiageqrpiywarysdwlfttplllydlgllagadrntisslvsldvlmigtg
lvatlsagsgvlsagaerlvwwgistafllvllyflfsslsgrvadlpsdtrstfktlrn
lvtvvwlvypvwwlvgtegiglvgigietagfmvidlvakvgfgiillrshgvldgaaet
tgag

Timeline for d4l35a_:

• d4l35a_ first appeared in SCOPe 2.04
  
• d4l35a_ appears in SCOPe 2.07