Lineage for d4l2ja_ (4l2j A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532544Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 1532545Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 1532546Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 1532611Protein automated matches [190195] (6 species)
    not a true protein
  7. 1532614Species Calotropis procera [TaxId:141467] [256968] (1 PDB entry)
  8. 1532615Domain d4l2ja_: 4l2j A: [256969]
    automated match to d2i0wa_

Details for d4l2ja_

PDB Entry: 4l2j (more details), 1.61 Å

PDB Description: crystal structure of osmotin, an antifungal laticifer protein
PDB Compounds: (A:) Osmotin: antifungal laticifer protein

SCOPe Domain Sequences for d4l2ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2ja_ b.25.1.1 (A:) automated matches {Calotropis procera [TaxId: 141467]}
atftirnncpytiwaaavpgggrrlnsgqtwtinvapgtagariwprtncnfdgagrgrc
qtgdcngvleckgygqppntlaeyalnqfqnldffdislvdgfnvpmefspvsgsgdkcr
airctadingqcpnelrapggcnnpctvfktdkyccnsgscgpttysrffkercwdaysy
pkddptstftcpsgtnyrvifcppg

SCOPe Domain Coordinates for d4l2ja_:

Click to download the PDB-style file with coordinates for d4l2ja_.
(The format of our PDB-style files is described here.)

Timeline for d4l2ja_: