Class b: All beta proteins [48724] (176 folds) |
Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) has two smaller insertion domains |
Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
Protein automated matches [190195] (6 species) not a true protein |
Species Calotropis procera [TaxId:141467] [256968] (1 PDB entry) |
Domain d4l2ja_: 4l2j A: [256969] automated match to d2i0wa_ |
PDB Entry: 4l2j (more details), 1.61 Å
SCOPe Domain Sequences for d4l2ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2ja_ b.25.1.1 (A:) automated matches {Calotropis procera [TaxId: 141467]} atftirnncpytiwaaavpgggrrlnsgqtwtinvapgtagariwprtncnfdgagrgrc qtgdcngvleckgygqppntlaeyalnqfqnldffdislvdgfnvpmefspvsgsgdkcr airctadingqcpnelrapggcnnpctvfktdkyccnsgscgpttysrffkercwdaysy pkddptstftcpsgtnyrvifcppg
Timeline for d4l2ja_: