SCOPe 2.07: Domain d4l21a_: 4l21 A:

Lineage for d4l21a_ (4l21 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)

6. Protein automated matches [190040] (1 species)
   not a true protein

7. Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)

8. Domain d4l21a_: 4l21 A: [256967]
   automated match to d1y21a_
   complexed with hem, no; mutant

Details for d4l21a_

PDB Entry: 4l21, 1.65 Å

PDB Description: Crystal structure of Cimex nitrophorin F64V mutant ferrous NO complex

PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d4l21a_:

Sequence; same for both SEQRES and ATOM records:

>d4l21a_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nvqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

Timeline for d4l21a_:

• d4l21a_ first appeared in SCOPe 2.04
  
• d4l21a_ appears in SCOPe 2.06
  
• d4l21a_ appears in the current release, SCOPe 2.08