Lineage for d4l21a_ (4l21 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594457Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2594467Protein automated matches [190040] (1 species)
    not a true protein
  7. 2594468Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)
  8. 2594472Domain d4l21a_: 4l21 A: [256967]
    automated match to d1y21a_
    complexed with hem, no; mutant

Details for d4l21a_

PDB Entry: 4l21 (more details), 1.65 Å

PDB Description: Crystal structure of Cimex nitrophorin F64V mutant ferrous NO complex
PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d4l21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l21a_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nvqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d4l21a_:

Click to download the PDB-style file with coordinates for d4l21a_.
(The format of our PDB-style files is described here.)

Timeline for d4l21a_: