Lineage for d4l20a_ (4l20 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676326Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 1676335Protein automated matches [190040] (1 species)
    not a true protein
  7. 1676336Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)
  8. 1676342Domain d4l20a_: 4l20 A: [256966]
    automated match to d1y21a_
    complexed with hem, no; mutant

Details for d4l20a_

PDB Entry: 4l20 (more details), 1.68 Å

PDB Description: Crystal structure of Cimex nitrophorin A21V mutant ferrous NO complex
PDB Compounds: (A:) Salivary nitrophorin

SCOPe Domain Sequences for d4l20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l20a_ d.151.1.2 (A:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsghervptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d4l20a_:

Click to download the PDB-style file with coordinates for d4l20a_.
(The format of our PDB-style files is described here.)

Timeline for d4l20a_: