SCOPe 2.06: Domain d4l1wb1: 4l1w B:2-323

Lineage for d4l1wb1 (4l1w B:2-323)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)

7. Species Human (Homo sapiens), type III [TaxId:9606] [69383] (15 PDB entries)
   bile acid binding protein

8. Domain d4l1wb1: 4l1w B:2-323 [256964]
   Other proteins in same PDB: d4l1wa2, d4l1wb2
   automated match to d1xjba_
   complexed with nap, so4, str

Details for d4l1wb1

PDB Entry: 4l1w, 2.2 Å

PDB Description: Crystal Structuer of Human 3-alpha Hydroxysteroid Dehydrogenase Type 3 in Complex with NADP+ and Progesterone

PDB Compounds: (B:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4l1wb1:

Sequence; same for both SEQRES and ATOM records:

>d4l1wb1 c.1.7.1 (B:2-323) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
dskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqv
glairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvs
vkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpg
lkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvl
calakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnr
nvryltldifagppnypfsdey

Timeline for d4l1wb1:

• d4l1wb1 first appeared in SCOPe 2.04, called d4l1wb_
  
• d4l1wb1 was called d4l1wb_ in SCOPe 2.05
  
• d4l1wb1 appears in SCOPe 2.07
  
• d4l1wb1 appears in the current release, SCOPe 2.08