Lineage for d4l1eb_ (4l1e B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689111Species Leptolyngbya sp. [TaxId:574115] [256954] (1 PDB entry)
  8. 2689112Domain d4l1eb_: 4l1e B: [256955]
    Other proteins in same PDB: d4l1ea_, d4l1ec_, d4l1ee_, d4l1eg_, d4l1ei_, d4l1ek_
    automated match to d2uumb_
    complexed with bla, cyc

Details for d4l1eb_

PDB Entry: 4l1e (more details), 2.61 Å

PDB Description: Crystal structure of C-Phycocyanin from Leptolyngbya sp. N62DM
PDB Compounds: (B:) phycocyanin beta chain

SCOPe Domain Sequences for d4l1eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1eb_ a.1.1.3 (B:) automated matches {Leptolyngbya sp. [TaxId: 574115]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldvvnritsnastivsnaarslf
aeqpqliapggnaytstrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d4l1eb_:

Click to download the PDB-style file with coordinates for d4l1eb_.
(The format of our PDB-style files is described here.)

Timeline for d4l1eb_: