Lineage for d4l1ea_ (4l1e A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718144Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1718148Species Leptolyngbya sp. [TaxId:574115] [256952] (1 PDB entry)
  8. 1718149Domain d4l1ea_: 4l1e A: [256953]
    Other proteins in same PDB: d4l1eb_, d4l1ed_, d4l1ef_, d4l1eh_, d4l1ej_, d4l1el_
    automated match to d1gh0a_
    complexed with bla, cyc

Details for d4l1ea_

PDB Entry: 4l1e (more details), 2.61 Å

PDB Description: Crystal structure of C-Phycocyanin from Leptolyngbya sp. N62DM
PDB Compounds: (A:) phycocyanin alpha chain

SCOPe Domain Sequences for d4l1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1ea_ a.1.1.3 (A:) Phycocyanin alpha subunit {Leptolyngbya sp. [TaxId: 574115]}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOPe Domain Coordinates for d4l1ea_:

Click to download the PDB-style file with coordinates for d4l1ea_.
(The format of our PDB-style files is described here.)

Timeline for d4l1ea_: