Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
Protein automated matches [190316] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries) |
Domain d4l0pb_: 4l0p B: [256951] Other proteins in same PDB: d4l0pa1, d4l0pa2 automated match to d4m4rb_ complexed with ca, nag, so4 |
PDB Entry: 4l0p (more details), 2.26 Å
SCOPe Domain Sequences for d4l0pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l0pb_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avadryavywnssnprfqrgdyhidvcindyldvfcphyedsvpedkteryvlymvnfdg ysacdhtskgfkrwecnrphspngplkfsekfqlftpfslgfefrpgreyfyissaipdn grrsclklkvfvrptnscm
Timeline for d4l0pb_: