Lineage for d4l0ga_ (4l0g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004171Protein automated matches [196672] (2 species)
    not a true protein
  7. 2004172Species Caldicellulosiruptor bescii [TaxId:521460] [196673] (5 PDB entries)
  8. 2004174Domain d4l0ga_: 4l0g A: [256949]
    automated match to d1l1ya_
    complexed with btb, cbi, edo

Details for d4l0ga_

PDB Entry: 4l0g (more details), 2 Å

PDB Description: crystal structure of a gh48 cellobiohydrolase from caldicellulosiruptor bescii
PDB Compounds: (A:) Glycoside hydrolase family 48

SCOPe Domain Sequences for d4l0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l0ga_ a.102.1.2 (A:) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
lgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwlea
vygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpdkypsplefn
vpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesv
wetvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakvwakeq
gkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawgg
aldgawswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlq
saegaiaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsmqrvae
yyyvtgdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgnsnlhv
kvvdygtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdekglsap
ekradykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaayksgq
apefryhrfwaqcdiaianatyeilfg

SCOPe Domain Coordinates for d4l0ga_:

Click to download the PDB-style file with coordinates for d4l0ga_.
(The format of our PDB-style files is described here.)

Timeline for d4l0ga_: