![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
![]() | Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries) |
![]() | Domain d1tuia1: 1tui A:213-313 [25693] Other proteins in same PDB: d1tuia2, d1tuia3, d1tuib2, d1tuib3, d1tuic2, d1tuic3 complexed with gdp, mg |
PDB Entry: 1tui (more details), 2.7 Å
SCOPe Domain Sequences for d1tuia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuia1 b.43.3.1 (A:213-313) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitph
Timeline for d1tuia1: