Lineage for d4kyua_ (4kyu A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128298Species Bacillus subtilis [TaxId:224308] [256925] (2 PDB entries)
  8. 2128299Domain d4kyua_: 4kyu A: [256926]
    automated match to d2dyka_
    complexed with gdp, k, mg, na, nh4

Details for d4kyua_

PDB Entry: 4kyu (more details), 1.7 Å

PDB Description: crystal structure of n-terminal g-domain of enga from bacillus subtilis
PDB Compounds: (A:) GTPase Der

SCOPe Domain Sequences for d4kyua_:

Sequence, based on SEQRES records: (download)

>d4kyua_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
gkpvvaivgrpnvgkstifnriagerisivedtpgvtrdriyssaewlnydfnlidtggi
digdepflaqirqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkl
dntemraniydfyslgfgepypisgthglglgdlldavaehf

Sequence, based on observed residues (ATOM records): (download)

>d4kyua_ c.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
gkpvvaivgrpnvgkstifnriagerirdriyssaewlnydfnlidtggidigdepflaq
irqqaeiamdeadviifmvngregvtaadeevakilyrtkkpvvlavnkldntemraniy
dfyslgfgepypisgthglglgdlldavaehf

SCOPe Domain Coordinates for d4kyua_:

Click to download the PDB-style file with coordinates for d4kyua_.
(The format of our PDB-style files is described here.)

Timeline for d4kyua_: