SCOPe 2.08: Domain d4kxrb_: 4kxr B:

Lineage for d4kxrb_ (4kxr B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.2: PPE [140463] (2 proteins)
   Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit

6. Protein automated matches [256922] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [256923] (2 PDB entries)

8. Domain d4kxrb_: 4kxr B: [256924]
   Other proteins in same PDB: d4kxra_
   automated match to d2g38b1

Details for d4kxrb_

PDB Entry: 4kxr, 2.6 Å

PDB Description: Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer

PDB Compounds: (B:) ppe41

SCOPe Domain Sequences for d4kxrb_:

Sequence; same for both SEQRES and ATOM records:

>d4kxrb_ a.25.4.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

Timeline for d4kxrb_:

• d4kxrb_ first appeared in SCOPe 2.04
  
• d4kxrb_ appears in SCOPe 2.07