Lineage for d4kxrb_ (4kxr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705398Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle
  5. 2705412Family a.25.4.2: PPE [140463] (2 proteins)
    Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit
  6. 2705420Protein automated matches [256922] (1 species)
    not a true protein
  7. 2705421Species Mycobacterium tuberculosis [TaxId:83332] [256923] (2 PDB entries)
  8. 2705423Domain d4kxrb_: 4kxr B: [256924]
    Other proteins in same PDB: d4kxra_
    automated match to d2g38b1

Details for d4kxrb_

PDB Entry: 4kxr (more details), 2.6 Å

PDB Description: Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer
PDB Compounds: (B:) ppe41

SCOPe Domain Sequences for d4kxrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxrb_ a.25.4.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

SCOPe Domain Coordinates for d4kxrb_:

Click to download the PDB-style file with coordinates for d4kxrb_.
(The format of our PDB-style files is described here.)

Timeline for d4kxrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4kxra_