![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle |
![]() | Family a.25.4.1: PE [140460] (2 proteins) Pfam PF00934; pairs with with the N-terminal hairpin of PPE |
![]() | Protein automated matches [256919] (2 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [256920] (2 PDB entries) |
![]() | Domain d4kxra_: 4kxr A: [256921] Other proteins in same PDB: d4kxrb_ automated match to d2g38a1 |
PDB Entry: 4kxr (more details), 2.6 Å
SCOPe Domain Sequences for d4kxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxra_ a.25.4.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti aaaavvleefahalttgadkyatae
Timeline for d4kxra_: