SCOPe 2.07: Domain d4kxra_: 4kxr A:

Lineage for d4kxra_ (4kxr A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.1: PE [140460] (2 protein domains)
   Pfam PF00934; pairs with with the N-terminal hairpin of PPE

6. Protein automated matches [256919] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [256920] (1 PDB entry)

8. Domain d4kxra_: 4kxr A: [256921]
   Other proteins in same PDB: d4kxrb_
   automated match to d2g38a1

Details for d4kxra_

PDB Entry: 4kxr, 2.6 Å

PDB Description: Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer

PDB Compounds: (A:) pe25

SCOPe Domain Sequences for d4kxra_:

Sequence; same for both SEQRES and ATOM records:

>d4kxra_ a.25.4.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
npealtvaatevrrirdraiqsdaqvapmttavrppaadlvsekaatflveyarkyrqti
aaaavvleefahalttgadkyatae

Timeline for d4kxra_:

• d4kxra_ first appeared in SCOPe 2.04
  
• d4kxra_ appears in SCOPe 2.06