| Class b: All beta proteins [48724] (177 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (10 proteins) |
| Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
| Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries) |
| Domain d1tttc1: 1ttt C:213-312 [25692] Other proteins in same PDB: d1ttta2, d1ttta3, d1tttb2, d1tttb3, d1tttc2, d1tttc3 protein/RNA complex; complexed with gnp, mg, phe |
PDB Entry: 1ttt (more details), 2.7 Å
SCOPe Domain Sequences for d1tttc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tttc1 b.43.3.1 (C:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1tttc1: