SCOPe 2.07: Domain d4kx4a2: 4kx4 A:76-215

Lineage for d4kx4a2 (4kx4 A:76-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries)

8. Domain d4kx4a2: 4kx4 A:76-215 [256918]
   Other proteins in same PDB: d4kx4a1, d4kx4a3
   automated match to d3ir4a2
   complexed with acy, gsh

Details for d4kx4a2

PDB Entry: 4kx4, 1.6 Å

PDB Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione

PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4kx4a2:

Sequence; same for both SEQRES and ATOM records:

>d4kx4a2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]}
plltgkrspaidewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

Timeline for d4kx4a2:

• d4kx4a2 first appeared in SCOPe 2.04
  
• d4kx4a2 appears in SCOPe 2.06
  
• d4kx4a2 appears in the current release, SCOPe 2.08