SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4kx4a2 (4kx4 A:76-215)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1997221Protein automated matches [226848] (11 species)
    not a true protein
  7. 1997232Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries)
  8. 1997233Domain d4kx4a2: 4kx4 A:76-215 [256918]
    Other proteins in same PDB: d4kx4a1, d4kx4a3
    automated match to d3ir4a2
    complexed with acy, gsh

Details for d4kx4a2

PDB Entry: 4kx4 (more details), 1.6 Å

PDB Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione
PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4kx4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx4a2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]}
plltgkrspaidewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

SCOPe Domain Coordinates for d4kx4a2:

Click to download the PDB-style file with coordinates for d4kx4a2.
(The format of our PDB-style files is described here.)

Timeline for d4kx4a2: