Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (14 species) not a true protein |
Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries) |
Domain d4kx4a2: 4kx4 A:76-215 [256918] Other proteins in same PDB: d4kx4a1, d4kx4a3 automated match to d3ir4a2 complexed with acy, gsh |
PDB Entry: 4kx4 (more details), 1.6 Å
SCOPe Domain Sequences for d4kx4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kx4a2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]} plltgkrspaidewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva dyrdnmakqtqinllssmai
Timeline for d4kx4a2: