Lineage for d4kx4a2 (4kx4 A:76-215)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1997221Protein automated matches [226848] (11 species)
    not a true protein
  7. 1997232Species Escherichia coli [TaxId:83333] [256898] (2 PDB entries)
  8. 1997233Domain d4kx4a2: 4kx4 A:76-215 [256918]
    Other proteins in same PDB: d4kx4a1, d4kx4a3
    automated match to d3ir4a2
    complexed with acy, gsh

Details for d4kx4a2

PDB Entry: 4kx4 (more details), 1.6 Å

PDB Description: Crystal structure of Escherichia coli glutaredoxin 2 complex with glutathione
PDB Compounds: (A:) Glutaredoxin-2

SCOPe Domain Sequences for d4kx4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx4a2 a.45.1.1 (A:76-215) automated matches {Escherichia coli [TaxId: 83333]}
plltgkrspaidewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

SCOPe Domain Coordinates for d4kx4a2:

Click to download the PDB-style file with coordinates for d4kx4a2.
(The format of our PDB-style files is described here.)

Timeline for d4kx4a2: