Class b: All beta proteins [48724] (165 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (5 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries) |
Domain d1tttb1: 1ttt B:213-312 [25691] Other proteins in same PDB: d1ttta2, d1ttta3, d1tttb2, d1tttb3, d1tttc2, d1tttc3 |
PDB Entry: 1ttt (more details), 2.7 Å
SCOP Domain Sequences for d1tttb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tttb1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1tttb1: