Lineage for d4kugb2 (4kug B:184-282)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742628Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)
  8. 1742638Domain d4kugb2: 4kug B:184-282 [256905]
    Other proteins in same PDB: d4kuga1, d4kugb1, d4kugc1, d4kugd1
    automated match to d3hada1
    complexed with nad

Details for d4kugb2

PDB Entry: 4kug (more details), 2.3 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with nad from clostridium butyricum
PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kugb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kugb2 a.100.1.0 (B:184-282) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydysk

SCOPe Domain Coordinates for d4kugb2:

Click to download the PDB-style file with coordinates for d4kugb2.
(The format of our PDB-style files is described here.)

Timeline for d4kugb2: