SCOPe 2.08: Domain d4kugb2: 4kug B:184-282

Lineage for d4kugb2 (4kug B:184-282)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)

8. Domain d4kugb2: 4kug B:184-282 [256905]
   Other proteins in same PDB: d4kuga1, d4kugb1, d4kugc1, d4kugd1
   automated match to d3hada1
   complexed with nad

Details for d4kugb2

PDB Entry: 4kug, 2.3 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with nad from clostridium butyricum

PDB Compounds: (B:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kugb2:

Sequence; same for both SEQRES and ATOM records:

>d4kugb2 a.100.1.0 (B:184-282) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydysk

Timeline for d4kugb2:

• d4kugb2 first appeared in SCOPe 2.04
  
• d4kugb2 appears in SCOPe 2.07