Lineage for d1b23p1 (1b23 P:213-312)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298343Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 298354Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 298355Family b.43.3.1: Elongation factors [50448] (6 proteins)
  6. 298377Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 298392Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 298393Domain d1b23p1: 1b23 P:213-312 [25689]
    Other proteins in same PDB: d1b23p2, d1b23p3
    complexed with aac, gnp, h2u, mg, mia, psu, s4u, so4

Details for d1b23p1

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex

SCOP Domain Sequences for d1b23p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p1 b.43.3.1 (P:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1b23p1:

Click to download the PDB-style file with coordinates for d1b23p1.
(The format of our PDB-style files is described here.)

Timeline for d1b23p1: