Lineage for d1b23p1 (1b23 P:213-312)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386038Family b.43.3.1: Elongation factors [50448] (11 protein domains)
  6. 2386122Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2386144Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 2386145Domain d1b23p1: 1b23 P:213-312 [25689]
    Other proteins in same PDB: d1b23p2, d1b23p3
    protein/RNA complex; complexed with cys, gnp, mg, so4

Details for d1b23p1

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: E. coli cysteinyl-tRNA and T. aquaticus elongation factor EF-TU:GTP ternary complex
PDB Compounds: (P:) elongation factor tu

SCOPe Domain Sequences for d1b23p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p1 b.43.3.1 (P:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1b23p1:

Click to download the PDB-style file with coordinates for d1b23p1.
(The format of our PDB-style files is described here.)

Timeline for d1b23p1: