SCOPe 2.07: Domain d4kp9a_: 4kp9 A:

Lineage for d4kp9a_ (4kp9 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Papain [54005] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54006] (24 PDB entries)

8. Domain d4kp9a_: 4kp9 A: [256886]
   automated match to d1cvza_
   complexed with act, bu1, cl, na, so4, yxx, yxz

Details for d4kp9a_

PDB Entry: 4kp9, 2.1 Å

PDB Description: crystal structure of papain modify by achiral ru(ii)complex

PDB Compounds: (A:) papain

SCOPe Domain Sequences for d4kp9a_:

Sequence; same for both SEQRES and ATOM records:

>d4kp9a_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
xgcnggxpwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

Timeline for d4kp9a_:

• d4kp9a_ first appeared in SCOPe 2.04
  
• d4kp9a_ appears in SCOPe 2.06
  
• d4kp9a_ does not appear in SCOPe 2.08