SCOPe 2.06: Domain d4ko9a_: 4ko9 A:

Lineage for d4ko9a_ (4ko9 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
   Uniprot P00282

8. Domain d4ko9a_: 4ko9 A: [256883]
   automated match to d1jzga_
   complexed with cu

Details for d4ko9a_

PDB Entry: 4ko9, 2.05 Å

PDB Description: Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V95I/Y108F)

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d4ko9a_:

Sequence; same for both SEQRES and ATOM records:

>d4ko9a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsitfdvsklkegeqfmffctfpghsal
mkgtltlk

Timeline for d4ko9a_:

• d4ko9a_ first appeared in SCOPe 2.04
  
• d4ko9a_ appears in SCOPe 2.05
  
• d4ko9a_ appears in SCOPe 2.07
  
• d4ko9a_ appears in the current release, SCOPe 2.08