Lineage for d4ko6a_ (4ko6 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1527469Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1527547Protein Azurin [49530] (6 species)
  7. 1527578Species Pseudomonas aeruginosa [TaxId:287] [49533] (86 PDB entries)
    Uniprot P00282
  8. 1527707Domain d4ko6a_: 4ko6 A: [256881]
    automated match to d1jzga_
    complexed with cu

Details for d4ko6a_

PDB Entry: 4ko6 (more details), 1.74 Å

PDB Description: Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95K/Y108F)
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d4ko6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko6a_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftinlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsktfdvsklkegeqfmffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d4ko6a_:

Click to download the PDB-style file with coordinates for d4ko6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ko6a_: