SCOP 1.57: Domain d1eft_1: 1eft 213-312

Lineage for d1eft_1 (1eft 213-312)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (4 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)

8. Domain d1eft_1: 1eft 213-312 [25688]
   Other proteins in same PDB: d1eft_2, d1eft_3

Details for d1eft_1

PDB Entry: 1eft, 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

SCOP Domain Sequences for d1eft_1:

Sequence; same for both SEQRES and ATOM records:

>d1eft_1 b.43.3.1 (213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

Timeline for d1eft_1:

• d1eft_1 first appeared (with stable ids) in SCOP 1.55
  
• d1eft_1 appears in SCOP 1.59
  
• d1eft_1 appears in the current release, SCOPe 2.08, called d1efta1