SCOPe 2.07: Domain d4kkza1: 4kkz A:8-120

Lineage for d4kkza1 (4kkz A:8-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries)

8. Domain d4kkza1: 4kkz A:8-120 [256866]
   Other proteins in same PDB: d4kkza2, d4kkzb2, d4kkzc2, d4kkzd2
   automated match to d1kbpa1
   complexed with 1rf, act, edo, fe, gol, na, nag, pge, so4, zn

Details for d4kkza1

PDB Entry: 4kkz, 2.2 Å

PDB Description: the crystal structure of red kidney bean purple acid phosphatase in complex with diethylene glycol monovanadate

PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d4kkza1:

Sequence; same for both SEQRES and ATOM records:

>d4kkza1 b.1.12.0 (A:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d4kkza1:

• d4kkza1 first appeared in SCOPe 2.04
  
• d4kkza1 appears in SCOPe 2.06
  
• d4kkza1 does not appear in SCOPe 2.08