Lineage for d4kkzb1 (4kkz B:8-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374702Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2374721Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2374722Protein automated matches [227090] (1 species)
    not a true protein
  7. 2374723Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries)
  8. 2374735Domain d4kkzb1: 4kkz B:8-120 [256864]
    Other proteins in same PDB: d4kkza2, d4kkzb2, d4kkzc2, d4kkzd2
    automated match to d1kbpa1
    complexed with 1rf, act, edo, fe, gol, na, nag, pge, so4, zn

Details for d4kkzb1

PDB Entry: 4kkz (more details), 2.2 Å

PDB Description: the crystal structure of red kidney bean purple acid phosphatase in complex with diethylene glycol monovanadate
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d4kkzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkzb1 b.1.12.0 (B:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d4kkzb1:

Click to download the PDB-style file with coordinates for d4kkzb1.
(The format of our PDB-style files is described here.)

Timeline for d4kkzb1: