Lineage for d4kkyx_ (4kky X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005501Species Pseudomonas putida [TaxId:303] [186787] (9 PDB entries)
  8. 2005509Domain d4kkyx_: 4kky X: [256863]
    automated match to d2a1na_
    complexed with 1t4, cam, hem, k

Details for d4kkyx_

PDB Entry: 4kky (more details), 2 Å

PDB Description: crystal structure of n-(1-pyrene)acetamide labeled p450cam in substrate bound form.
PDB Compounds: (X:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d4kkyx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkyx_ a.104.1.1 (X:) automated matches {Pseudomonas putida [TaxId: 303]}
etiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsnggh
wiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfrclanqvvgmp
vvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltd
qmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmc
glllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgrilt
sdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhl
arreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka

SCOPe Domain Coordinates for d4kkyx_:

Click to download the PDB-style file with coordinates for d4kkyx_.
(The format of our PDB-style files is described here.)

Timeline for d4kkyx_: