Lineage for d4kkka_ (4kkk A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498424Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1498646Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 1498647Protein automated matches [190108] (10 species)
    not a true protein
  7. 1498653Species Clostridium cellulovorans [TaxId:1493] [256855] (2 PDB entries)
  8. 1498655Domain d4kkka_: 4kkk A: [256862]
    automated match to d1l1ya_
    complexed with ca

Details for d4kkka_

PDB Entry: 4kkk (more details), 2.88 Å

PDB Description: complex structure of catalytic domain of clostridium cellulovorans exgs and cellotetraose
PDB Compounds: (A:) Exoglucanase S

SCOPe Domain Sequences for d4kkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkka_ a.102.1.0 (A:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
pvvpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyym
wleamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmy
psqlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqrg
vqescwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaql
aakewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgg
gissnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlq
saeggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvae
yyysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlh
vkveaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqdd
kgiavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnveaa
langtgvdmtyhrfwgqsdiaiafgtygtlftd

SCOPe Domain Coordinates for d4kkka_:

Click to download the PDB-style file with coordinates for d4kkka_.
(The format of our PDB-style files is described here.)

Timeline for d4kkka_: