Lineage for d1d8ta1 (1d8t A:205-296)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801311Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 801318Species Escherichia coli [TaxId:562] [50450] (7 PDB entries)
    Uniprot P02990
  8. 801327Domain d1d8ta1: 1d8t A:205-296 [25686]
    Other proteins in same PDB: d1d8ta2, d1d8ta3, d1d8tb2, d1d8tb3

Details for d1d8ta1

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic
PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d1d8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ta1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1d8ta1:

Click to download the PDB-style file with coordinates for d1d8ta1.
(The format of our PDB-style files is described here.)

Timeline for d1d8ta1: