SCOP 1.65: Domain d1d8ta1: 1d8t A:205-296

Lineage for d1d8ta1 (1d8t A:205-296)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology

7. Species Escherichia coli [TaxId:562] [50450] (4 PDB entries)

8. Domain d1d8ta1: 1d8t A:205-296 [25686]
   Other proteins in same PDB: d1d8ta2, d1d8ta3, d1d8tb2, d1d8tb3

Details for d1d8ta1

PDB Entry: 1d8t, 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

SCOP Domain Sequences for d1d8ta1:

Sequence; same for both SEQRES and ATOM records:

>d1d8ta1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

Timeline for d1d8ta1:

• d1d8ta1 first appeared (with stable ids) in SCOP 1.55
  
• d1d8ta1 appears in SCOP 1.63
  
• d1d8ta1 appears in SCOP 1.67
  
• d1d8ta1 appears in the current release, SCOPe 2.08