Lineage for d4kgab_ (4kga B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2066947Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries)
  8. 2066995Domain d4kgab_: 4kga B: [256854]
    automated match to d2bdga_
    complexed with edo, ni

Details for d4kgab_

PDB Entry: 4kga (more details), 2.32 Å

PDB Description: crystal structure of kallikrein-related peptidase 4
PDB Compounds: (B:) Kallikrein-4

SCOPe Domain Sequences for d4kgab_:

Sequence, based on SEQRES records: (download)

>d4kgab_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsleadq
epgsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclv
sgwgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggp
licngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

Sequence, based on observed residues (ATOM records): (download)

>d4kgab_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iingedcsphsqpwqaalvmenelfcsgvlvhpqwvlsaahcfqnsytiglglhsldqep
gsqmveaslsvrhpeynrpllandlmlikldesvsesdtirsisiasqcptagnsclvsg
wgllangrmptvlqcvnvsvvseevcsklydplyhpsmfcagggqdqkdscngdsggpli
cngylqglvsfgkapcgqvgvpgvytnlckftewiektvqa

SCOPe Domain Coordinates for d4kgab_:

Click to download the PDB-style file with coordinates for d4kgab_.
(The format of our PDB-style files is described here.)

Timeline for d4kgab_: