![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
![]() | Species Escherichia coli [TaxId:562] [50450] (7 PDB entries) Uniprot P02990 |
![]() | Domain d1dg1h1: 1dg1 H:205-296 [25685] Other proteins in same PDB: d1dg1g2, d1dg1g3, d1dg1h2, d1dg1h3 |
PDB Entry: 1dg1 (more details), 2.5 Å
SCOP Domain Sequences for d1dg1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dg1h1 b.43.3.1 (H:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d1dg1h1: