Lineage for d4k8ma1 (4k8m A:1002-1079)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876489Species Mycobacterium tuberculosis [TaxId:1773] [226696] (2 PDB entries)
  8. 2876491Domain d4k8ma1: 4k8m A:1002-1079 [256846]
    Other proteins in same PDB: d4k8ma2
    automated match to d4hs1a_
    complexed with cl, gol, no3, peg

Details for d4k8ma1

PDB Entry: 4k8m (more details), 0.87 Å

PDB Description: High resolution structure of M.tb NRDH
PDB Compounds: (A:) glutaredoxin-like protein nrdh

SCOPe Domain Sequences for d4k8ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8ma1 c.47.1.1 (A:1002-1079) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaalta

SCOPe Domain Coordinates for d4k8ma1:

Click to download the PDB-style file with coordinates for d4k8ma1.
(The format of our PDB-style files is described here.)

Timeline for d4k8ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k8ma2