Lineage for d4k6ra1 (4k6r A:6-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899373Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries)
  8. 2899375Domain d4k6ra1: 4k6r A:6-263 [256841]
    Other proteins in same PDB: d4k6ra2
    automated match to d3d8va1
    complexed with atp, co, gn1, mg

Details for d4k6ra1

PDB Entry: 4k6r (more details), 1.98 Å

PDB Description: crystal structure of glmu in complex with atp
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4k6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6ra1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
elaselnrrvvaahqlag

SCOPe Domain Coordinates for d4k6ra1:

Click to download the PDB-style file with coordinates for d4k6ra1.
(The format of our PDB-style files is described here.)

Timeline for d4k6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k6ra2