![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries) |
![]() | Domain d4k6ra1: 4k6r A:6-263 [256841] Other proteins in same PDB: d4k6ra2 automated match to d3d8va1 complexed with atp, co, gn1, mg |
PDB Entry: 4k6r (more details), 1.98 Å
SCOPe Domain Sequences for d4k6ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k6ra1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla elaselnrrvvaahqlag
Timeline for d4k6ra1: