Lineage for d1dg1g1 (1dg1 G:205-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793069Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2793076Species Escherichia coli [TaxId:562] [50450] (9 PDB entries)
    Uniprot P02990
  8. 2793079Domain d1dg1g1: 1dg1 G:205-296 [25684]
    Other proteins in same PDB: d1dg1g2, d1dg1g3, d1dg1h2, d1dg1h3
    complexed with gdp, mg

Details for d1dg1g1

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).
PDB Compounds: (G:) elongation factor tu

SCOPe Domain Sequences for d1dg1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1g1 b.43.3.1 (G:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d1dg1g1:

Click to download the PDB-style file with coordinates for d1dg1g1.
(The format of our PDB-style files is described here.)

Timeline for d1dg1g1: