Lineage for d1efuc1 (1efu C:205-296)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1544127Species Escherichia coli [TaxId:562] [50450] (8 PDB entries)
    Uniprot P02990
  8. 1544135Domain d1efuc1: 1efu C:205-296 [25683]
    Other proteins in same PDB: d1efua2, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc2, d1efuc3, d1efud2, d1efud3, d1efud4

Details for d1efuc1

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli
PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d1efuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efuc1 b.43.3.1 (C:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d1efuc1:

Click to download the PDB-style file with coordinates for d1efuc1.
(The format of our PDB-style files is described here.)

Timeline for d1efuc1: